PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi3g39970.3.p
Common NameBRADI_3g39970, LOC100821424
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family EIL
Protein Properties Length: 613aa    MW: 68331.9 Da    PI: 5.8365
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi3g39970.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3407.22e-124383821314
                       XXXXXXXXXXXXXXXXXXXXXXX..XXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
              EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaatgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLra 93 
                       +el +rmwkd+++ kr+ker+++l   ++a+++++ks+++++ a rkk++ra DgiLkYMlk mevcna+GfvYgiip+kgkpv+gasd++ra
  Bradi3g39970.3.p  38 DELARRMWKDKVRFKRIKERQQKLA-LQQAELENAKSKNISDLALRKKIARAHDGILKYMLKLMEVCNARGFVYGIIPDKGKPVSGASDNIRA 129
                       79*******************9865.66667************************************************************** PP

                       XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT- CS
              EIN3  94 WWkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelgl 186
                       WWkekv+fd+ngpaai+ky+ +n +l +  s+   ++ + hsl++lqD+tlgSLLsalmqhc+p+qr++pl+kg++pPWWP+G+e+ww +lgl
  Bradi3g39970.3.p 130 WWKEKVKFDKNGPAAIAKYEVENSVLFNTTSS---GTTNEHSLMDLQDATLGSLLSALMQHCSPQQRKYPLDKGIPPPWWPSGNEEWWIALGL 219
                       ***************************98888...889******************************************************* PP

                       -TT--.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX.XX...XXXX...XXX CS
              EIN3 187 skdqgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah.ss...slrk...qsp 272
                       +k    ppykkphdlkk+wkv+vLt vikhm+p++ +ir+ +++sk+lqdkm+akes ++lsvl++ee+ ++++ +  s+          +++
  Bradi3g39970.3.p 220 PKGKT-PPYKKPHDLKKVWKVGVLTGVIKHMAPNFGKIRNYVLKSKCLQDKMTAKESLIWLSVLQREENYIHSIDSGvSEithR--YelgDKN 309
                       *9987.******************************************************************999995445431..2455677 PP

                       XXXXXXXXXXXXXXXXXXX.XXXXXXXXXX.................................XXXXXXXXXXXX CS
              EIN3 273 kvtlsceqkedvegkkeskikhvqavktta.................................gfpvvrkrkkkp 314
                          +s+++++dv+  +++  ++ ++++  a                                 +++  rkrk  +
  Bradi3g39970.3.p 310 GNSYSSSDEYDVDCLEKPPHSATSKDSVGAhqlalqirednvssrgdrkhldkqstralpsdkKTKESRKRK--R 382
                       788899999****55555546666666655778888888888888888855555555555533333333333..2 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.6E-12238286No hitNo description
Gene3DG3DSA:1.10.3180.108.7E-68161292IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167681.83E-59166289IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 613 aa     Download sequence    Send to blast
MDHLAIVPSE LGDVSDFEVD GIQNLTENDV SDEEIEADEL ARRMWKDKVR FKRIKERQQK  60
LALQQAELEN AKSKNISDLA LRKKIARAHD GILKYMLKLM EVCNARGFVY GIIPDKGKPV  120
SGASDNIRAW WKEKVKFDKN GPAAIAKYEV ENSVLFNTTS SGTTNEHSLM DLQDATLGSL  180
LSALMQHCSP QQRKYPLDKG IPPPWWPSGN EEWWIALGLP KGKTPPYKKP HDLKKVWKVG  240
VLTGVIKHMA PNFGKIRNYV LKSKCLQDKM TAKESLIWLS VLQREENYIH SIDSGVSEIT  300
HRYELGDKNG NSYSSSDEYD VDCLEKPPHS ATSKDSVGAH QLALQIREDN VSSRGDRKHL  360
DKQSTRALPS DKKTKESRKR KRRTGQFPVD ESVVEVMQRN GDLPEVFSNA IPDMNRNQME  420
VPPMANRLTS VNNVSTSVAL PHQGHAEENF ISPGPVAINY NCNQTTDATH SSVYIGEQPL  480
ACDSSDYRNP WPVDNFQQDL SLVPIGFSSP PLDYHTSAAK QSLPLSMVPT MGTGALVENT  540
SYNHHMAASG NSISVAGDAH QIMSDDFYID PDDKFVGSSF EGLPLDFIGI NSPIPDLDEL  600
LDDDDLMQYL GT*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wij_A2e-6116929012133ETHYLENE-INSENSITIVE3-like 3 protein
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1377382RKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235295.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
RefseqXP_014757042.10.0PREDICTED: ETHYLENE INSENSITIVE 3-like 3 protein
SwissprotO231161e-138EIL3_ARATH; ETHYLENE INSENSITIVE 3-like 3 protein
TrEMBLI1I8G10.0I1I8G1_BRADI; Uncharacterized protein
STRINGBRADI3G39970.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73730.11e-134ETHYLENE-INSENSITIVE3-like 3